Recombinant Human GPX5 protein, His-GST-tagged

• Cat.No.: GPX5-4280H
• Product Overview: Recombinant Human GPX5 protein(O75715)(1-100aa), fused to N-terminal His tag and GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST&His
• Protein Length: 1-100aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 42.9 kDa
• AA Sequence: MTTQLRVVHLLPLLLACFVQTSPKQEKMKMDCHKDEKGTIYDYEAIALNKNEYVSFKQYVGKHILFVNVATYCGLTAQYPGMSVQGEDLYLVSSFLRKGM
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: GPX5 glutathione peroxidase 5 (epididymal androgen-related protein) [ Homo sapiens ]
• Official Symbol: GPX5
• Synonyms: GPX5; glutathione peroxidase 5 (epididymal androgen-related protein); epididymal secretory glutathione peroxidase; EGLP; GPx-5; GSHPx-5; epididymal androgen-related protein; epididymis-specific glutathione peroxidase-like protein
• Gene ID: 2880
• mRNA Refseq: NM_001509
• Protein Refseq: NP_001500
• MIM: 603435
• UniProt ID: O75715