Recombinant Human GPX5 Protein (1-100 aa), His-Trx-tagged
Cat.No. : | GPX5-2142H |
Product Overview : | Recombinant Human GPX5 Protein (1-100 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-Trx tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length of Isoform 2. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Trx |
Protein Length : | 1-100 aa |
Description : | Protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione. May constitute a glutathione peroxidase-like protective system against peroxide damage in sperm membrane lipids. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 28.4 kDa |
AA Sequence : | MTTQLRVVHLLPLLLACFVQTSPKQEKMKMDCHKDEKGTIYDYEAIALNKNEYVSFKQYVGKHILFVNVATYCGLTAQYPGMSVQGEDLYLVSSFLRKGM |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | GPX5 glutathione peroxidase 5 (epididymal androgen-related protein) [ Homo sapiens ] |
Official Symbol | GPX5 |
Synonyms | GPX5; EGLP; GPx-5; GSHPx-5; epididymal androgen-related protein; |
Gene ID | 2880 |
mRNA Refseq | NM_001509 |
Protein Refseq | NP_001500 |
MIM | 603435 |
UniProt ID | O75715 |
◆ Recombinant Proteins | ||
GPX5-5583HF | Recombinant Full Length Human GPX5 Protein, GST-tagged | +Inquiry |
GPX5-310C | Recombinant Cynomolgus Monkey GPX5 Protein, His (Fc)-Avi-tagged | +Inquiry |
GPX5-1232P | Recombinant Pig GPX5 Protein, His/MYC-tagged | +Inquiry |
GPX5-2156P | Recombinant Pig GPX5 Protein (22-219 aa), His-Myc-tagged | +Inquiry |
Gpx5-1107R | Recombinant Rat Gpx5 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GPX5 Products
Required fields are marked with *
My Review for All GPX5 Products
Required fields are marked with *
0
Inquiry Basket