Recombinant Human GPX5 Protein (1-100 aa), His-Trx-tagged

• Cat.No.: GPX5-2142H
• Product Overview: Recombinant Human GPX5 Protein (1-100 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-Trx tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length of Isoform 2.

Specification

• Description: Protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione. May constitute a glutathione peroxidase-like protective system against peroxide damage in sperm membrane lipids.
• Source: E. coli
• Species: Human
• Tag: His&Trx
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 28.4 kDa
• Protein length: 1-100 aa
• AA Sequence: MTTQLRVVHLLPLLLACFVQTSPKQEKMKMDCHKDEKGTIYDYEAIALNKNEYVSFKQYVGKHILFVNVATYCGLTAQYPGMSVQGEDLYLVSSFLRKGM
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: GPX5 glutathione peroxidase 5 (epididymal androgen-related protein) [ Homo sapiens ]
• Official Symbol: GPX5
• Synonyms: GPX5; EGLP; GPx-5; GSHPx-5; epididymal androgen-related protein
• Gene ID: 2880
• mRNA Refseq: NM_001509
• Protein Refseq: NP_001500
• MIM: 603435
• UniProt ID: O75715