Recombinant Human GPX5 Protein, GST-tagged

Description :	This gene belongs to the glutathione peroxidase family. It is specifically expressed in the epididymis in the mammalian male reproductive tract, and is androgen-regulated. Unlike mRNAs for other characterized glutathione peroxidases, this mRNA does not contain a selenocysteine (UGA) codon. Thus, the encoded protein is selenium-independent, and has been proposed to play a role in protecting the membranes of spermatozoa from the damaging effects of lipid peroxidation and/or preventing premature acrosome reaction. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq
Source :	Wheat Germ
Species :	Human
Tag :	GST
Molecular Mass :	37.8 kDa
AA Sequence :	MTTQLRVVHLLPLLLACFVQTSPKQEKMKMDCHKDEKGTIYDYEAIALNKNEYVSFKQYVGKHILFVNVATYCGLTAQYPGMSVQGEDLYLVSSFLRKGM
Applications :	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	GPX5 glutathione peroxidase 5 (epididymal androgen-related protein) [ Homo sapiens ]
Official Symbol	GPX5
Synonyms	GPX5; glutathione peroxidase 5 (epididymal androgen-related protein); epididymal secretory glutathione peroxidase; EGLP; GPx-5; GSHPx-5; epididymal androgen-related protein; epididymis-specific glutathione peroxidase-like protein;
Gene ID	2880
mRNA Refseq	NM_001509
Protein Refseq	NP_001500
MIM	603435
UniProt ID	O75715