Recombinant Human GPX2 Protein, His-tagged

• Cat.No.: GPX2-5309H
• Product Overview: Human GPX2 (NP_002074, 1 a.a. - 190 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: This gene is a member of the glutathione peroxidase family and encodes a selenium-dependent glutathione peroxidase that is one of two isoenzymes responsible for the majority of the glutathione-dependent hydrogen peroxide-reducing activity in the epithelium of the gastrointestinal tract. Studies in knockout mice indicate that mRNA expression levels respond to luminal microflora, suggesting a role of the ileal glutathione peroxidases in preventing inflammation in the GI tract. [provided by RefSeq
• Form: Liquid
• Molecular Mass: 24.1 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMAFIAKSFYDLSAISLDGEKVDFNTFRGRAVLIENVASLCGTTTRDFTQLNELQCRFPRRLVVLGFPCNQFGHQENCQNEEILNSLKYVRPGGGYQPTFTLVQKCEVNGQNEHPVFAYLKDKLPYPYDDPFSLMTDPKLIIWSPVRRSDVAWNFEKFLIGPEGEPFRRYSRTFPTINIEPDIKRLLKVAI
• Purity: > 95% by SDS-PAGE
• Applications: Functional Study
  SDS-PAGE
• Storage: Store at 4 centigrade for 1-2 weeks. For long term storage store at -20 centigrade or -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Concentration: 0.25 mg/mL
• Storage Buffer: In 20 mM Tris-HCl, 0.15 M NaCl, pH7.5. (40% glycerol, 1 mM DTT)

Gene Information

• Gene Name: GPX2 glutathione peroxidase 2 (gastrointestinal) [ Homo sapiens ]
• Official Symbol: GPX2
• Synonyms: GPX2; glutathione peroxidase 2 (gastrointestinal); glutathione peroxidase 2; GSHPX GI; glutathione peroxidase-gastrointestinal; glutathione peroxidase-related protein 2; gastrointestinal glutathione peroxidase 2; GPRP; GPx-2; GI-GPx; GPRP-2; GPx-GI; GSHPx-2; GSHPX-GI
• Gene ID: 2877
• mRNA Refseq: NM_002083
• Protein Refseq: NP_002074
• MIM: 138319
• UniProt ID: P18283