Recombinant Human GPX1 protein, His-SUMO-tagged

• Cat.No.: GPX1-2990H
• Product Overview: Recombinant Human GPX1 protein(P07203)(1-203aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1-203aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 38.1 kDa
• AA Sequence: MCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLSGTTVRDYTQMNELQRRLGPRGLVVLGFPCNQFGHQENAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGAGAHPLFAFLREALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYSRRFQTIDIEPDIEALLSQGPSCA
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: GPX1 glutathione peroxidase 1 [ Homo sapiens ]
• Official Symbol: GPX1
• Synonyms: GPX1; glutathione peroxidase 1; GPx-1; GSHPx-1; cellular glutathione peroxidase; GPXD; GSHPX1; MGC14399; MGC88245
• Gene ID: 2876
• mRNA Refseq: NM_000581
• Protein Refseq: NP_000572
• MIM: 138320
• UniProt ID: P07203