Recombinant Human GPX1 protein, His-SUMO-tagged

Cat.No. : GPX1-2990H
Product Overview : Recombinant Human GPX1 protein(P07203)(1-203aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : E. coli
Species : Human
Tag : His&SUMO
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 38.1 kDa
Protein length : 1-203aa
AA Sequence : MCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLSGTTVRDYTQMNELQRRLGPRGLVVLGFPCNQFGHQENAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGAGAHPLFAFLREALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYSRRFQTIDIEPDIEALLSQGPSCA
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name GPX1 glutathione peroxidase 1 [ Homo sapiens ]
Official Symbol GPX1
Synonyms GPX1; glutathione peroxidase 1; GPx-1; GSHPx-1; cellular glutathione peroxidase; GPXD; GSHPX1; MGC14399; MGC88245;
Gene ID 2876
mRNA Refseq NM_000581
Protein Refseq NP_000572
MIM 138320
UniProt ID P07203

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GPX1 Products

Required fields are marked with *

My Review for All GPX1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon