Recombinant Human GPX1, His-tagged

• Cat.No.: GPX1-29074TH
• Product Overview: Recombinant full length Human Glutathione Peroxidase 1 with an N terminal His tag ; mwt: 24.2 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 203 amino acids
• Description: This gene encodes a member of the glutathione peroxidase family. Glutathione peroxidase functions in the detoxification of hydrogen peroxide, and is one of the most important antioxidant enzymes in humans. This protein is one of only a few proteins known in higher vertebrates to contain selenocysteine, which occurs at the active site of glutathione peroxidase and is coded by UGA, that normally functions as a translation termination codon. In addition, this protein is characterized in a polyalanine sequence polymorphism in the N-terminal region, which includes three alleles with five, six or seven alanine (ALA) repeats in this sequence. The allele with five ALA repeats is significantly associated with breast cancer risk. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
• Conjugation: HIS
• Molecular Weight: 24.200kDa inclusive of tags
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 30% Glycerol, 0.04% DTT, 0.58% Sodium chloride
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLCGTTVRDYTQMNELQRRLGPRGLVVLGFPCNQFGHQENAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGAGAHPLFAFLREALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYSRRFQTIDIEPDIEALLSQGPSCA
• Sequence Similarities: Belongs to the glutathione peroxidase family.

Gene Information

• Gene Name: GPX1 glutathione peroxidase 1 [ Homo sapiens ]
• Official Symbol: GPX1
• Synonyms: GPX1; glutathione peroxidase 1
• Gene ID: 2876
• mRNA Refseq: NM_000581
• Protein Refseq: NP_000572
• MIM: 138320
• Uniprot ID: P07203
• Chromosome Location: 3p21.3
• Pathway: Amyotrophic lateral sclerosis (ALS), organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), conserved biosystem; Arachidonic acid metabolism, organism-specific biosystem; Arachidonic acid metabolism, conserved biosystem; Direct p53 effectors, organism-specific biosystem
• Function: SH3 domain binding; endopeptidase inhibitor activity; glutathione peroxidase activity; glutathione peroxidase activity; oxidoreductase activity