Recombinant Human GPX1, His-tagged

Cat.No. : GPX1-29074TH
Product Overview : Recombinant full length Human Glutathione Peroxidase 1 with an N terminal His tag ; mwt: 24.2 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 203 amino acids
Description : This gene encodes a member of the glutathione peroxidase family. Glutathione peroxidase functions in the detoxification of hydrogen peroxide, and is one of the most important antioxidant enzymes in humans. This protein is one of only a few proteins known in higher vertebrates to contain selenocysteine, which occurs at the active site of glutathione peroxidase and is coded by UGA, that normally functions as a translation termination codon. In addition, this protein is characterized in a polyalanine sequence polymorphism in the N-terminal region, which includes three alleles with five, six or seven alanine (ALA) repeats in this sequence. The allele with five ALA repeats is significantly associated with breast cancer risk. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Conjugation : HIS
Molecular Weight : 24.200kDa inclusive of tags
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 30% Glycerol, 0.04% DTT, 0.58% Sodium chloride
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLCGTTVRDYTQMNELQRRLGPRGLVVLGFPCNQFGHQENAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGAGAHPLFAFLREALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYSRRFQTIDIEPDIEALLSQGPSCA
Sequence Similarities : Belongs to the glutathione peroxidase family.
Gene Name GPX1 glutathione peroxidase 1 [ Homo sapiens ]
Official Symbol GPX1
Synonyms GPX1; glutathione peroxidase 1;
Gene ID 2876
mRNA Refseq NM_000581
Protein Refseq NP_000572
MIM 138320
Uniprot ID P07203
Chromosome Location 3p21.3
Pathway Amyotrophic lateral sclerosis (ALS), organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), conserved biosystem; Arachidonic acid metabolism, organism-specific biosystem; Arachidonic acid metabolism, conserved biosystem; Direct p53 effectors, organism-specific biosystem;
Function SH3 domain binding; endopeptidase inhibitor activity; glutathione peroxidase activity; glutathione peroxidase activity; oxidoreductase activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GPX1 Products

Required fields are marked with *

My Review for All GPX1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon