Recombinant Human GPRC5D protein(261-345aa), His-tagged

• Cat.No.: GPRC5D-1399H
• Product Overview: Recombinant Human GPRC5D protein(Q9NZD1)(261-345aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Source: E.coli
• Species: Human
• Tag: His
• Protein length: 261-345aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 13.4 kDa
• AASequence: ELCILYRSCRQECPLQGNACPVTAYQHSFQVENQELSRARDSDGAEEDVALTSYGTPIQPQTVDPTQECFIPQAKLSPQQDAGGV
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: GPRC5D G protein-coupled receptor, family C, group 5, member D [ Homo sapiens ]
• Official Symbol: GPRC5D
• Synonyms: GPRC5D; G protein-coupled receptor, family C, group 5, member D; G-protein coupled receptor family C group 5 member D; orphan G-protein coupled receptor; MGC129713; MGC129714
• Gene ID: 55507
• mRNA Refseq: NM_018654
• Protein Refseq: NP_061124
• MIM: 607437
• UniProt ID: Q9NZD1