Recombinant Human GPRC5D Protein, GST-tagged

• Cat.No.: GPRC5D-501H
• Product Overview: Recombinant Human GPRC5D Protien(NP_061124)(256-345 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 256-345 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
• AA Sequence: LYIVPELCILYRSCRQECPLQGNACPVTAYQHSFQVENQELSRARDSDGAEEDVALTSYGTPIQPQTVDPTQECFIPQAKLSPQQDAGGV
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).
  If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).
  Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.

Gene Information

• Gene Name: GPRC5D G protein-coupled receptor, family C, group 5, member D [ Homo sapiens ]
• Official Symbol: GPRC5D
• Synonyms: GPRC5D; G protein-coupled receptor, family C, group 5, member D; G-protein coupled receptor family C group 5 member D; orphan G-protein coupled receptor; MGC129713; MGC129714
• Gene ID: 55507
• mRNA Refseq: NM_018654.1
• Protein Refseq: NP_061124
• MIM: 607437
• UniProt ID: Q9NZD1