Recombinant Human GPR31 Protein, GST-tagged

• Cat.No.: GPR31-5232H
• Product Overview: Human GPR31 full-length ORF ( NP_005290.1, 1 a.a. - 319 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: GPR31 (G Protein-Coupled Receptor 31) is a Protein Coding gene. Among its related pathways are Peptide ligand-binding receptors and Signaling by GPCR. GO annotations related to this gene include G-protein coupled receptor activity. An important paralog of this gene is HCAR3.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 61.5 kDa
• AA Sequence: MPFPNCSAPSTVVATAVGVLLGLECGLGLLGNAVALWTFLFRVRVWKPYAVYLLNLALADLLLAACLPFLAAFYLSLQAWHLGRVGCWALRFLLDLSRSVGMAFLAAVALDRYLRVVHPRLKVNLLSPQAALGVSGLVWLLMVALTCPGLLISEAAQNSTRCHSFYSRADGSFSIIWQEALSCLQFVLPFGLIVFCNAGIIRALQKRLREPEKQPKLQRAQALVTLVVVLFALCFLPCFLARVLMHIFQNLGSCRALCAVAHTSDVTGSLTYLHSVLNPVVYCFSSPTFRSSYRRVFHTLRGKGQAAEPPDFNPRDSYS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GPR31 G protein-coupled receptor 31 [ Homo sapiens ]
• Official Symbol: GPR31
• Synonyms: GPR31; G protein-coupled receptor 31; 12-(S)-hydroxy-5,8,10,14-eicosatetraenoic acid receptor; 12 (S) HETE acid receptor; 12 HETER; HETER1; hydroxyeicosatetraenoic (HETE) acid receptor 1; 12-(S)-HETE receptor; 12-(S)-HETE acid receptor; G-protein coupled receptor 31; probable G-protein coupled receptor 31; bA517H2.2 (G protein-coupled receptor 31); 12-(S)-hydroxy-5,8,10,14-eicosatetraenoic acid (HETE) receptor; HETER; 12-HETER
• Gene ID: 2853
• mRNA Refseq: NM_005299
• Protein Refseq: NP_005290
• MIM: 602043
• UniProt ID: O00270