Recombinant Full Length Human 12-(S)-Hydroxy-5,8,10,14-Eicosatetraenoic Acid Receptor(Gpr31) Protein, His-Tagged

• Cat.No.: RFL22852HF
• Product Overview: Recombinant Full Length Human 12-(S)-hydroxy-5,8,10,14-eicosatetraenoic acid receptor(GPR31) Protein (O00270) (1-319aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Source: E.coli expression system
• Species: Homo sapiens (Human)
• Tag: His
• Form: Lyophilized powder
• Protein length: Full Length (1-319)
• AA Sequence: MPFPNCSAPSTVVATAVGVLLGLECGLGLLGNAVALWTFLFRVRVWKPYAVYLLNLALAD LLLAACLPFLAAFYLSLQAWHLGRVGCWALHFLLDLSRSVGMAFLAAVALDRYLRVVHPR LKVNLLSPQAALGVSGLVWLLMVALTCPGLLISEAAQNSTRCHSFYSRADGSFSIIWQEA LSCLQFVLPFGLIVFCNAGIIRALQKRLREPEKQPKLQRAQALVTLVVVLFALCFLPCFL ARVLMHIFQNLGSCRALCAVAHTSDVTGSLTYLHSVLNPVVYCFSSPTFRSSYRRVFHTL RGKGQAAEPPDFNPRDSYS
• Purity: Greater than 90% as determined by SDS-PAGE.
• Applications: SDS-PAGE
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: GPR31
• Synonyms: GPR31; 12-(S-hydroxy-5,8,10,14-eicosatetraenoic acid receptor; 12-(S-HETE receptor; 12-HETER; G-protein coupled receptor 31; GPR31/12-HETER
• UniProt ID: O00270