Recombinant Human GPR161 Protein, GST-tagged

• Cat.No.: GPR161-5205H
• Product Overview: Human GPR161 partial ORF ( NP_722561.1, 362 a.a. - 460 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Upon ligand binding, G protein-coupled receptors, such as GPR161, activate cytoplasmic G proteins (see GNAS, MIM 139320), allowing the receptors to transduce extracellular signals across the plasma membrane into the cell. Phosphorylation of the receptor attenuates signaling (Matteson et al., 2008 [PubMed 18250320]).[supplied by OMIM
• Molecular Mass: 36.63 kDa
• AA Sequence: SNRITDLGLSPHLTALMAGGQPLGHSSSTGDTGFSCSQDSGTDMMLLEDYTSDDNPPSHCTCPPKRRSSVTFEDEVEQIKEAAKNSILHVKAEVHKSLD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GPR161 G protein-coupled receptor 161 [ Homo sapiens ]
• Official Symbol: GPR161
• Synonyms: GPR161; G protein-coupled receptor 161; G-protein coupled receptor 161; RE2; G-protein coupled receptor RE2; FLJ33952
• Gene ID: 23432
• mRNA Refseq: NM_153832
• Protein Refseq: NP_722561
• MIM: 612250
• UniProt ID: Q8N6U8