Recombinant Human GPR143 Protein

• Cat.No.: GPR143-5188H
• Product Overview: Human GPR143 full-length ORF (NP_000264.1) recombinant protein without tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Description: Ocular albinism type 1 protein is a conserved integral membrane protein with seven transmembrane domains. It is expressed in the eye and epidermal melanocytes. [provided by RefSeq
• Form: Liquid
• Molecular Mass: 46.1 kDa
• AA Sequence: MTQAGRRGPGTPEPRPRTQPMASPRLGTFCCPTRDAATQLVLSFQPRAFHALCLGSGGLRLALGLLQLLPGRRPAGPGSPATSPPASVRILRAAAACDLLGCLGMVIRSTVWLGFPNFVDSVSDMNHTEIWPAAFCVGSAMWIQLLYSACFWWLFCYAVDAYLVIRRSAGLSTILLYHIMAWGLATLLCVEGAAMLYYPSVSRCERGLDHAIPHYVTMYLPLLLVLVANPILFQKTVTAVASLLKGRQGIYTENERRMGAVIKIRFFKIMLVLIICWLSNIINESLLFYLEMQTDINGGSLKPVRTAAKTTWFIMGILNPAQGFLLSLAFYGWTGCSLGFQSPRKEIQWESLTTSAAEGAHPSPLMPHENPASGKVSQVGGQTSDEALSMLSEGSDASTIEIHTASESCNKNEGDPALPTHGDL
• Applications: Antibody Production
  Functional Study
  Compound Screening
• Usage: Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.

Gene Information

• Gene Name: GPR143 G protein-coupled receptor 143 [ Homo sapiens ]
• Official Symbol: GPR143
• Synonyms: GPR143; G protein-coupled receptor 143; OA1, ocular albinism 1 (Nettleship Falls); G-protein coupled receptor 143; ocular albinism 1 (Nettleship Falls); ocular albinism type 1 protein; OA1; NYS6
• Gene ID: 4935
• mRNA Refseq: NM_000273
• Protein Refseq: NP_000264
• MIM: 300808
• UniProt ID: P51810