Recombinant Full Length Human GPR143 Protein, GST-tagged

• Cat.No.: GPR143-5640HF
• Product Overview: Human GPR143 full-length ORF ( NP_000264.1, 1 a.a. - 424 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Ocular albinism type 1 protein is a conserved integral membrane protein with seven transmembrane domains. It is expressed in the eye and epidermal melanocytes. [provided by RefSeq
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 72.5 kDa
• Protein length: 424 amino acids
• AA Sequence: MTQAGRRGPGTPEPRPRTQPMASPRLGTFCCPTRDAATQLVLSFQPRAFHALCLGSGGLRLALGLLQLLPGRRPAGPGSPATSPPASVRILRAAAACDLLGCLGMVIRSTVWLGFPNFVDSVSDMNHTEIWPAAFCVGSAMWIQLLYSACFWWLFCYAVDAYLVIRRSAGLSTILLYHIMAWGLATLLCVEGAAMLYYPSVSRCERGLDHAIPHYVTMYLPLLLVLVANPILFQKTVTAVASLLKGRQGIYTENERRMGAVIKIRFFKIMLVLIICWLSNIINESLLFYLEMQTDINGGSLKPVRTAAKTTWFIMGILNPAQGFLLSLAFYGWTGCSLGFQSPRKEIQWESLTTSAAEGAHPSPLMPHENPASGKVSQVGGQTSDEALSMLSEGSDASTIEIHTASESCNKNEGDPALPTHGDL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GPR143 G protein-coupled receptor 143 [ Homo sapiens ]
• Official Symbol: GPR143
• Synonyms: GPR143; G protein-coupled receptor 143; OA1, ocular albinism 1 (Nettleship Falls); G-protein coupled receptor 143; ocular albinism 1 (Nettleship Falls); ocular albinism type 1 protein; OA1; NYS6
• Gene ID: 4935
• mRNA Refseq: NM_000273
• Protein Refseq: NP_000264
• MIM: 300808
• UniProt ID: P51810