Recombinant Human GPR132 Protein, GST-tagged

• Cat.No.: GPR132-5182H
• Product Overview: Human GPR132 partial ORF (NP_037477.1, 281 a.a. - 380 a.a.) recombinant protein with GST tag at N-terminal.

Specification

• Description: This gene encodes a subfamily member of the G-protein couple receptor (GPCR) superfamily. The encoded protein is a high-affinity receptor for lysophosphatidylcholine (LPC), a major phospholipid component of oxidized low density lipoprotein. This protein may react to LPC levels at sites of inflammation to limit the expansion of tissue-infiltrating cells. A similar protein in mouse is involved in cell cycle progression. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.63 kDa
• AA Sequence: GLEERLYTASVVFLCLSTVNGVADPIIYVLATDHSRQEVSRIHKGWKEWSMKTDVTRLTHSRDTEELQSPVALADHYTFSRPVHPPGSPCPAKRLIEESC
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Protein length: 281-380 a.a.

Gene Information

• Gene Name: GPR132 G protein-coupled receptor 132 [ Homo sapiens ]
• Official Symbol: GPR132
• Synonyms: GPR132; G protein-coupled receptor 132; probable G-protein coupled receptor 132; G2 accumulation; G2A; G2 accumulation protein; G protein-coupled receptor G2A; MGC99642
• Gene ID: 29933
• mRNA Refseq: NM_013345
• Protein Refseq: NP_037477
• MIM: 606167
• UniProt ID: Q9UNW8