Recombinant Human GPR132 protein(311-380aa), His-GST-tagged

• Cat.No.: GPR132-8542H
• Product Overview: Recombinant Human GPR132 protein(Q9UNW8)(311-380aa), fused with N-terminal His and GST tag, was expressed in E.coli.

Specification

• Source: E.coli
• Species: Human
• Tag: N-His-GST
• Protein length: 311-380aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 39.5 kDa
• AASequence: ATDHSRQEVSRIHKGWKEWSMKTDVTRLTHSRDTEELQSPVALADHYTFSRPVHPPGSPCPAKRLIEESC
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: GPR132 G protein-coupled receptor 132 [ Homo sapiens ]
• Official Symbol: GPR132
• Synonyms: GPR132; G protein-coupled receptor 132; probable G-protein coupled receptor 132; G2 accumulation; G2A; G2 accumulation protein; G protein-coupled receptor G2A; MGC99642
• Gene ID: 29933
• mRNA Refseq: NM_013345
• Protein Refseq: NP_037477
• MIM: 606167
• UniProt ID: Q9UNW8