Recombinant Human GPR132 protein(311-380aa), His-GST-tagged
Cat.No. : | GPR132-8542H |
Product Overview : | Recombinant Human GPR132 protein(Q9UNW8)(311-380aa), fused with N-terminal His and GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Source : | E.coli |
Species : | Human |
Tag : | N-His-GST |
Protein length : | 311-380aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 39.5 kDa |
AASequence : | ATDHSRQEVSRIHKGWKEWSMKTDVTRLTHSRDTEELQSPVALADHYTFSRPVHPPGSPCPAKRLIEESC |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | GPR132 G protein-coupled receptor 132 [ Homo sapiens ] |
Official Symbol | GPR132 |
Synonyms | GPR132; G protein-coupled receptor 132; probable G-protein coupled receptor 132; G2 accumulation; G2A; G2 accumulation protein; G protein-coupled receptor G2A; MGC99642; |
Gene ID | 29933 |
mRNA Refseq | NM_013345 |
Protein Refseq | NP_037477 |
MIM | 606167 |
UniProt ID | Q9UNW8 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All GPR132 Products
Required fields are marked with *
My Review for All GPR132 Products
Required fields are marked with *
0
Inquiry Basket