Recombinant Human GPC1

• Cat.No.: GPC1-29027TH
• Product Overview: Recombinant fragment of Human Glypican 1/ GPC1 with N terminal proprietary tag, 37.51kDa inclusive of tag.

Specification

• Description: Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family (GRIPS) contain a core protein anchored to the cytoplasmic membrane via a glycosyl phosphatidylinositol linkage.These proteins may play a role in the control of cell division and growth regulation.
• Protein length: 108 amino acids
• Molecular Weight: 37.510kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: DPASKSRSCGEVRQIYGAKGFSLSDVPQAEISGEHLRICP QGYTCCTSEMEENLANRSHAELETALRDSSRVLQAMLATQ LRSFDDHFQHLLNDSERTLQATFPGAFG
• Sequence Similarities: Belongs to the glypican family.
• Tag: Non

Gene Information

• Gene Name: GPC1 glypican 1 [ Homo sapiens ]
• Official Symbol: GPC1
• Synonyms: GPC1; glypican 1; glypican-1; glypican; glypican proteoglycan 1
• Gene ID: 2817
• mRNA Refseq: NM_002081
• Protein Refseq: NP_002072
• MIM: 600395
• Uniprot ID: P35052
• Chromosome Location: 2q35-q37
• Pathway: Activation of Rac, organism-specific biosystem; Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Glypican 1 network, organism-specific biosystem; Glypican pathway, organism-specific biosystem
• Function: heparan sulfate proteoglycan binding