Recombinant Human GOSR2 Protein, GST-tagged

• Cat.No.: GOSR2-5125H
• Product Overview: Human GOSR2 full-length ORF ( NP_473363.1, 1 a.a. - 213 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a trafficking membrane protein which transports proteins among the medial- and trans-Golgi compartments. Due to its chromosomal location and trafficking function, this gene may be involved in familial essential hypertension. Three transcript variants encoding three different isoforms have been found for this gene. [provided by RefSeq
• Molecular Mass: 51 kDa
• AA Sequence: MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYFMIGTQGSCQTAHFGGRSAGSS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GOSR2 golgi SNAP receptor complex member 2 [ Homo sapiens ]
• Official Symbol: GOSR2
• Synonyms: GOSR2; golgi SNAP receptor complex member 2; Golgi SNAP receptor complex member 2; Bos1; GS27; membrin; 27 kDa Golgi SNARE protein; EPM6
• Gene ID: 9570
• mRNA Refseq: NM_001012511
• Protein Refseq: NP_001012529
• MIM: 604027
• UniProt ID: O14653