Recombinant Human GOSR2 protein, His-tagged

• Cat.No.: GOSR2-7568H
• Product Overview: Recombinant Human GOSR2 protein(NP_001012529)(1-192 aa), fused to His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
• Protein length: 1-192 aa
• AA Sequence: MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYF
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: GOSR2 golgi SNAP receptor complex member 2 [ Homo sapiens ]
• Official Symbol: GOSR2
• Synonyms: GOSR2; golgi SNAP receptor complex member 2; Golgi SNAP receptor complex member 2; Bos1; GS27; membrin; 27 kDa Golgi SNARE protein; EPM6
• Gene ID: 9570
• mRNA Refseq: NM_001012511
• Protein Refseq: NP_001012529
• MIM: 604027
• UniProt ID: O14653