Recombinant Human GNRH1 Protein

• Cat.No.: GNRH1-060H
• Product Overview: Recombinant human GNRH1 protein

Specification

• Species: Human
• Protein Length: 92
• Description: This gene encodes a preproprotein that is proteolytically processed to generate a peptide that is a member of the gonadotropin-releasing hormone (GnRH) family of peptides. Alternative splicing results in multiple transcript variants, at least one of which is secreted and then cleaved to generate gonadoliberin-1 and GnRH-associated peptide 1. Gonadoliberin-1 stimulates the release of luteinizing and follicle stimulating hormones, which are important for reproduction. Mutations in this gene are associated with hypogonadotropic hypogonadism.
• Form: Lyophilized
• Molecular Mass: 1.182 kDa
• AA Sequence: MKPIQKLLAGLILLTWCVEGCSSQHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI
• Purity: > 98%
• Applications: WB; ELISA; FACS; FC
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: 4°C
• Concentration: 1 mg/mL
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered colorless solution (reconst).
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: GNRH1 gonadotropin releasing hormone 1 [ Homo sapiens (human) ]
• Official Symbol: GNRH1
• Synonyms: GNRH1; gonadotropin releasing hormone 1; GRH; GNRH; LHRH; LNRH; progonadoliberin-1; GnRH-associated peptide 1; gonadotropin-releasing hormone 1 (luteinizing-releasing hormone); leuteinizing-releasing hormone; luliberin I; prolactin release-inhibiting factor
• Gene ID: 2796
• mRNA Refseq: NM_000825
• Protein Refseq: NP_000816
• MIM: 152760
• UniProt ID: P01148