Recombinant Human GNRH1 Protein, GST-tagged

• Cat.No.: GNRH1-5096H
• Product Overview: Human GNRH1 full-length ORF ( NP_000816.1, 1 a.a. - 92 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a preproprotein that is proteolytically processed to generate a peptide that is a member of the gonadotropin-releasing hormone (GnRH) family of peptides. Alternative splicing results in multiple transcript variants, at least one of which is secreted and then cleaved to generate gonadoliberin-1 and GnRH-associated peptide 1. Gonadoliberin-1 stimulates the release of luteinizing and follicle stimulating hormones, which are important for reproduction. Mutations in this gene are associated with hypogonadotropic hypogonadism. [provided by RefSeq, Nov 2015]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 35.75 kDa
• AA Sequence: MKPIQKLLAGLILLTWCVEGCSSQHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GNRH1 gonadotropin-releasing hormone 1 (luteinizing-releasing hormone) [ Homo sapiens ]
• Official Symbol: GNRH1
• Synonyms: GNRH1; gonadotropin-releasing hormone 1 (luteinizing-releasing hormone); GNRH, gonadotropin releasing hormone 1 (leutinizing releasing hormone), GRH, LHRH; progonadoliberin-1; luliberin I; progonadoliberin I; GnRH-associated peptide 1; prolactin release-inhibiting factor; gonadotropin-releasing hormone 1 (leutinizing-releasing hormone); GRH; GNRH; LHRH; LNRH
• Gene ID: 2796
• mRNA Refseq: NM_000825
• Protein Refseq: NP_000816
• MIM: 152760
• UniProt ID: P01148