Recombinant Human GNPTG Protein, GST-tagged

• Cat.No.: GNPTG-5095H
• Product Overview: Human GNPTG full-length ORF ( AAH14592, 19 a.a. - 304 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: UDP-N-acetylglucosamine:lysosomal-enzyme N-acetylglucosamine-1-phosphotransferase (GlcNAc-phosphotransferase) catalyzes the initial step in the synthesis of the mannose 6-phosphate determinant required for efficient intracellular targeting of newly synthesized lysosomal hydrolases to the lysosome. GlcNAc-phosphotransferase is an alpha-2/beta-2/gamma-2 hexameric complex, the enzyme product of 2 genes, 1 encoded by a gene on chromosome 16 (GNPTG) and the other by a gene on chromosome 12 (GNPTAB; MIM 607840).[supplied by OMIM
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 57.2 kDa
• AA Sequence: PAPAGAAKMKVVEEPNAFGVNNPFLPQASRLQAKRDPSPVSGPVHLFRLSGKCFSLVESTYKYEFCPFHNVTQHEQTFRWNAYSGILGIWHEWEIANNTFTGMWMRDGDACRSRSRQSKVELACGKSNRLAHVSEPSTCVYALTFETPLVCHPHALLVYPTLPEALQRQWDRVEQDLADELITPQGHEKLLRTLFEDAGYLKTPENEPTQLEGGPDSLGFETLENCRKAHKELSKEIKRLKGLLTQHGIPYTRPTETSNLEHLGHETPRAKSPEQLRGDPGLRGSL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GNPTG N-acetylglucosamine-1-phosphate transferase, gamma subunit [ Homo sapiens ]
• Official Symbol: GNPTG
• Synonyms: GNPTG; N-acetylglucosamine-1-phosphate transferase, gamma subunit; C16orf27, chromosome 16 open reading frame 27, GNPTAG, N acetylglucosamine 1 phosphotransferase, gamma subunit; N-acetylglucosamine-1-phosphotransferase subunit gamma; c316G12.3; CAB56184; GlcNAc phosphotransferase gamma subunit; glcNAc-1-phosphotransferase subunit gamma; UDP-N-acetylglucosamine-1-phosphotransferase subunit gamma; RJD9; GNPTAG; LP2537; C16orf27
• Gene ID: 84572
• mRNA Refseq: NM_032520
• Protein Refseq: NP_115909
• MIM: 607838
• UniProt ID: Q9UJJ9