Recombinant Full Length Human GNPTG Protein, GST-tagged

Cat.No. : GNPTG-5406HF
Product Overview : Human GNPTG full-length ORF ( AAH14592, 19 a.a. - 304 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 19-304 amino acids
Description : UDP-N-acetylglucosamine:lysosomal-enzyme N-acetylglucosamine-1-phosphotransferase (GlcNAc-phosphotransferase) catalyzes the initial step in the synthesis of the mannose 6-phosphate determinant required for efficient intracellular targeting of newly synthesized lysosomal hydrolases to the lysosome. GlcNAc-phosphotransferase is an alpha-2/beta-2/gamma-2 hexameric complex, the enzyme product of 2 genes, 1 encoded by a gene on chromosome 16 (GNPTG) and the other by a gene on chromosome 12 (GNPTAB; MIM 607840).[supplied by OMIM
Molecular Mass : 57.2 kDa
AA Sequence : PAPAGAAKMKVVEEPNAFGVNNPFLPQASRLQAKRDPSPVSGPVHLFRLSGKCFSLVESTYKYEFCPFHNVTQHEQTFRWNAYSGILGIWHEWEIANNTFTGMWMRDGDACRSRSRQSKVELACGKSNRLAHVSEPSTCVYALTFETPLVCHPHALLVYPTLPEALQRQWDRVEQDLADELITPQGHEKLLRTLFEDAGYLKTPENEPTQLEGGPDSLGFETLENCRKAHKELSKEIKRLKGLLTQHGIPYTRPTETSNLEHLGHETPRAKSPEQLRGDPGLRGSL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GNPTG N-acetylglucosamine-1-phosphate transferase, gamma subunit [ Homo sapiens ]
Official Symbol GNPTG
Synonyms GNPTG; N-acetylglucosamine-1-phosphate transferase, gamma subunit; C16orf27, chromosome 16 open reading frame 27, GNPTAG, N acetylglucosamine 1 phosphotransferase, gamma subunit; N-acetylglucosamine-1-phosphotransferase subunit gamma; c316G12.3; CAB56184; GlcNAc phosphotransferase gamma subunit; glcNAc-1-phosphotransferase subunit gamma; UDP-N-acetylglucosamine-1-phosphotransferase subunit gamma; RJD9; GNPTAG; LP2537; C16orf27;
Gene ID 84572
mRNA Refseq NM_032520
Protein Refseq NP_115909
MIM 607838
UniProt ID Q9UJJ9

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GNPTG Products

Required fields are marked with *

My Review for All GNPTG Products

Required fields are marked with *

0

Inquiry Basket

cartIcon