Recombinant Human GNMT Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | GNMT-535H |
Product Overview : | GNMT MS Standard C13 and N15-labeled recombinant protein (NP_061833) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is an enzyme that catalyzes the conversion of S-adenosyl-L-methionine (along with glycine) to S-adenosyl-L-homocysteine and sarcosine. This protein is found in the cytoplasm and acts as a homotetramer. Defects in this gene are a cause of GNMT deficiency (hypermethioninemia). Alternative splicing results in multiple transcript variants. Naturally occurring readthrough transcription occurs between the upstream CNPY3 (canopy FGF signaling regulator 3) gene and this gene and is represented with GeneID:107080644. |
Molecular Mass : | 32.7 kDa |
AA Sequence : | MVDSVYRTRSLGVAAEGLPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCQRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRHEPAFDKWVIEEANWMTLDKDVPQSAEGGFDAVICLGNSFAHLPDCKGDQSEHRLALKNIASMVRAGGLLVIDHRNYDHILSTGCAPPGKNIYYKSDLTKDVTTSVLIVNNKAHMVTLDYTVQVPGAGQDGSPGLSKFRLSYYPHCLASFTELLQAAFGGKCQHSVLGDFKPYKPGQTYIPCYFIHVLKRTDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | GNMT glycine N-methyltransferase [ Homo sapiens (human) ] |
Official Symbol | GNMT |
Synonyms | GNMT; glycine N-methyltransferase; HEL-S-182mP; glycine N-methyltransferase; epididymis secretory sperm binding protein Li 182mP; EC 2.1.1.20 |
Gene ID | 27232 |
mRNA Refseq | NM_018960 |
Protein Refseq | NP_061833 |
MIM | 606628 |
UniProt ID | Q14749 |
◆ Recombinant Proteins | ||
GNMT-2612R | Recombinant Rat GNMT Protein | +Inquiry |
GNMT-5400HF | Recombinant Full Length Human GNMT Protein, GST-tagged | +Inquiry |
GNMT-535H | Recombinant Human GNMT Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GNMT-577H | Recombinant Human GNMT Protein, His-tagged | +Inquiry |
GNMT-3570H | Recombinant Human GNMT Protein (Met1-Asp295), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNMT-5844HCL | Recombinant Human GNMT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GNMT Products
Required fields are marked with *
My Review for All GNMT Products
Required fields are marked with *
0
Inquiry Basket