Recombinant Full Length Human GNMT Protein, GST-tagged

• Cat.No.: GNMT-5400HF
• Product Overview: Human GNMT full-length ORF ( AAH32627, 1 a.a. - 295 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene is an enzyme that catalyzes the conversion of S-adenosyl-L-methionine (along with glycine) to S-adenosyl-L-homocysteine and sarcosine. The encoded protein is found in the cytoplasm and acts as a homotetramer. Defects in this gene are a cause of GNMT deficiency (hypermethioninemia). [provided by RefSeq
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 58.19 kDa
• Protein length: 295 amino acids
• AA Sequence: MVDSVYRTRSLGVAAEGLPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCQRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRHEPAFDKWVIEEANWMTLDKDVPQSAEGGFDAVICLGNSFAHLPDCKGDQSEHRLALKNIASMVRAGGLLVIDHRNYDHILSTGCAPPGKNIYYKSDLTKDVTTSVLIVNNKAHIVTLDYTVQVPGAGQDGSPGLSKFRLSYYPHCLASFTELLQAAFGGKCQHSVLGDFKPYKPGQTYIPCYFIHALKRTD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GNMT glycine N-methyltransferase [ Homo sapiens ]
• Official Symbol: GNMT
• Synonyms: GNMT; glycine N-methyltransferase
• Gene ID: 27232
• mRNA Refseq: NM_018960
• Protein Refseq: NP_061833
• MIM: 606628
• UniProt ID: Q14749