Recombinant Human GNGT2 Protein, GST-tagged

• Cat.No.: GNGT2-5077H
• Product Overview: Human GNGT2 full-length ORF ( AAH08663, 1 a.a. - 69 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Phototransduction in rod and cone photoreceptors is regulated by groups of signaling proteins. The encoded protein is thought to play a crucial role in cone phototransduction. It belongs to the G protein gamma family and localized specifically in cones. There is evidence for use of multiple polyadenylation sites by this gene. [provided by RefSeq
• Molecular Mass: 33.33 kDa
• AA Sequence: MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GNGT2 guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 2 [ Homo sapiens ]
• Official Symbol: GNGT2
• Synonyms: GNGT2; guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 2; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2; GNG9; G-gamma-9; g gamma-C; gamma-T2 subunit; G protein cone gamma 8 subunit; guanine nucleotide binding protein gamma 9; guanine nucleotide binding protein gamma transducing activity polypeptide 2; GNG8; GNGT8; G-GAMMA-8; G-GAMMA-C
• Gene ID: 2793
• mRNA Refseq: NM_001198754
• Protein Refseq: NP_001185683
• MIM: 139391
• UniProt ID: O14610