Recombinant Human GNG2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: GNG2-5291H
• Product Overview: GNG2 MS Standard C13 and N15-labeled recombinant protein (NP_444292) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes one of the gamma subunits of a guanine nucleotide-binding protein. Such proteins are involved in signaling mechanisms across membranes. Various subunits forms heterodimers which then interact with the different signal molecules.
• Molecular Mass: 7.9 kDa
• AA Sequence: MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREKKFFCAILTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: GNG2 G protein subunit gamma 2 [ Homo sapiens (human) ]
• Official Symbol: GNG2
• Synonyms: GNG2; guanine nucleotide binding protein (G protein), gamma 2; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2; g gamma-I; guanine nucleotide binding protein gamma 2; guanine nucleotide-binding protein G(I)/G(O) gamma-2 subunit
• Gene ID: 54331
• mRNA Refseq: NM_053064
• Protein Refseq: NP_444292
• MIM: 606981
• UniProt ID: P59768