Recombinant Human GNG2 Protein, GST-tagged
Cat.No. : | GNG2-5068H |
Product Overview : | Human GNG2 full-length ORF ( AAH20774, 1 a.a. - 71 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Heterotrimeric G proteins play vital roles in cellular responses to external signals. The specificity of a G protein-receptor interaction is primarily mediated by the gamma subunit.[supplied by OMIM |
Molecular Mass : | 33.55 kDa |
AA Sequence : | MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREKKFFCAIL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GNG2 guanine nucleotide binding protein (G protein), gamma 2 [ Homo sapiens ] |
Official Symbol | GNG2 |
Synonyms | GNG2; guanine nucleotide binding protein (G protein), gamma 2; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2; g gamma-I; guanine nucleotide binding protein gamma 2; guanine nucleotide-binding protein G(I)/G(O) gamma-2 subunit; |
Gene ID | 54331 |
mRNA Refseq | NM_001243773 |
Protein Refseq | NP_001230702 |
MIM | 606981 |
UniProt ID | P59768 |
◆ Recombinant Proteins | ||
GNG2-1724R | Recombinant Rhesus Macaque GNG2 Protein, His (Fc)-Avi-tagged | +Inquiry |
GNG2-5387HF | Recombinant Full Length Human GNG2 Protein, GST-tagged | +Inquiry |
GNG2-7036M | Recombinant Mouse GNG2 Protein | +Inquiry |
GNG2-3689C | Recombinant Chicken GNG2 | +Inquiry |
GNG2-5291H | Recombinant Human GNG2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNG2-5853HCL | Recombinant Human GNG2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GNG2 Products
Required fields are marked with *
My Review for All GNG2 Products
Required fields are marked with *
0
Inquiry Basket