Recombinant Human GNG2 Protein, GST-tagged

• Cat.No.: GNG2-5068H
• Product Overview: Human GNG2 full-length ORF ( AAH20774, 1 a.a. - 71 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Heterotrimeric G proteins play vital roles in cellular responses to external signals. The specificity of a G protein-receptor interaction is primarily mediated by the gamma subunit.[supplied by OMIM
• Molecular Mass: 33.55 kDa
• AA Sequence: MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREKKFFCAIL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GNG2 guanine nucleotide binding protein (G protein), gamma 2 [ Homo sapiens ]
• Official Symbol: GNG2
• Synonyms: GNG2; guanine nucleotide binding protein (G protein), gamma 2; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2; g gamma-I; guanine nucleotide binding protein gamma 2; guanine nucleotide-binding protein G(I)/G(O) gamma-2 subunit
• Gene ID: 54331
• mRNA Refseq: NM_001243773
• Protein Refseq: NP_001230702
• MIM: 606981
• UniProt ID: P59768