Recombinant Human GNG11 Protein, GST-tagged

• Cat.No.: GNG11-5064H
• Product Overview: Human GNG11 full-length ORF ( AAH09709, 1 a.a. - 73 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene is a member of the guanine nucleotide-binding protein (G protein) gamma family and encodes a lipid-anchored, cell membrane protein. As a member of the heterotrimeric G protein complex, this protein plays a role in this transmembrane signaling system. This protein is also subject to carboxyl-terminal processing. Decreased expression of this gene is associated with splenic marginal zone lymphomas. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 33.77 kDa
• AA Sequence: MPALHIEDLPEKEKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSGEDPLVKGIPEDKNPFKEKGSCVIS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GNG11 guanine nucleotide binding protein (G protein), gamma 11 [ Homo sapiens ]
• Official Symbol: GNG11
• Synonyms: GNG11; guanine nucleotide binding protein (G protein), gamma 11; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11; G protein gamma 11 subunit; GNGT11; guanine nucleotide binding protein G(I)/G(S)/G(O) gamma 11 subunit; G protein gamma-11 subunit; guanine nucleotide-binding protein G(I)/G(S)/G(O) gamma-11 subunit
• Gene ID: 2791
• mRNA Refseq: NM_004126
• Protein Refseq: NP_004117
• MIM: 604390
• UniProt ID: P61952