Recombinant Human GNG11 Protein, GST-tagged

Cat.No. : GNG11-5064H
Product Overview : Human GNG11 full-length ORF ( AAH09709, 1 a.a. - 73 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene is a member of the guanine nucleotide-binding protein (G protein) gamma family and encodes a lipid-anchored, cell membrane protein. As a member of the heterotrimeric G protein complex, this protein plays a role in this transmembrane signaling system. This protein is also subject to carboxyl-terminal processing. Decreased expression of this gene is associated with splenic marginal zone lymphomas. [provided by RefSeq
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 33.77 kDa
AA Sequence : MPALHIEDLPEKEKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSGEDPLVKGIPEDKNPFKEKGSCVIS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GNG11 guanine nucleotide binding protein (G protein), gamma 11 [ Homo sapiens ]
Official Symbol GNG11
Synonyms GNG11; guanine nucleotide binding protein (G protein), gamma 11; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11; G protein gamma 11 subunit; GNGT11; guanine nucleotide binding protein G(I)/G(S)/G(O) gamma 11 subunit; G protein gamma-11 subunit; guanine nucleotide-binding protein G(I)/G(S)/G(O) gamma-11 subunit;
Gene ID 2791
mRNA Refseq NM_004126
Protein Refseq NP_004117
MIM 604390
UniProt ID P61952

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GNG11 Products

Required fields are marked with *

My Review for All GNG11 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon