Recombinant Human GNE, His-tagged
Cat.No. : | GNE-94H |
Product Overview : | Recombinant Human Bifunctional UDP-N-Acetylglucosamine 2-Epimerase/N-Acetylmannosamine Kinase/GNE is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Tyr722) of Human GNE fused with a 6His tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Description : | Bifunctional UDP-N-Acetylglucosamine 2-Epimerase/N-Acetylmannosamine Kinase (GNE) contains two regions: UDP-N-acetylglucosamine 2-epimerase that belongs to the UDP-N-acetylglucosamine 2-epimerase family and N-acetylmannosamine kinase that belongs to the ROK (NagC/XylR) family. GNE localizes to the cytoplasm and exists as a homodimer and homohexamer. GNE is widely expressed, with the highest levels observed in the liver and placenta. GNE regulates and initiates biosynthesis of N-acetylneuraminic acid (NeuAc), a precursor of sialic acids. It is required for normal sialylation in hematopoietic cells. Sialylation is implicated in cell adhesion, signal transduction, tumorigenicity, and metastatic behavior of malignant cells. In addition, GNE plays an essential role in early development. |
AA Sequence : | MEKNGNNRKLRVCVATCNRADYSKLAPIMFGIKTEPEFFELDVVVLGSHLIDDYGNTYRMIEQDD FDINTRLHTIVRGEDEAAMVESVGLALVKLPDVLNRLKPDIMIVHGDRFDALALATSAALMNIRI LHIEGGEVSGTIDDSIRHAITKLAHYHVCCTRSAEQHLISMCEDHDRILLAGCPSYDKLLSAKNK DYMSIIRMWLGDDVKSKDYIVALQHPVTTDIKHSIKMFELTLDALISFNKRTLVLFPNIDAGSKE MVRVMRKKGIEHHPNFRAVKHVPFDQFIQLVAHAGCMIGNSSCGVREVGAFGTPVINLGTRQIGR ETGENVLHVRDADTQDKILQALHLQFGKQYPCSKIYGDGNAVPRILKFLKSIDLQEPLQKKFCFP PVKENISQDIDHILETLSALAVDLGGTNLRVAIVSMKGEIVKKYTQFNPKTYEERINLILQMCVE AAAEAVKLNCRILGVGISTGGRVNPREGIVLHSTKLIQEWNSVDLRTPLSDTLHLPVWVDNDGNC AALAERKFGQGKGLENFVTLITGTGIGGGIIHQHELIHGSSFCAAELGHLVVSLDGPDCSCGSHG CIEAYASGMALQREAKKLHDEDLLLVEGMSVPKDEAVGALHLIQAAKLGNAKAQSILRTAGTALG LGVVNILHTMNPSLVILSGVLASHYIHIVKDVIRQQALSSVQDVDVVVSDLVDPALLGAASMVLD YTTRRIYVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Gene Name | GNE glucosamine (UDP-N-acetyl)-2-epimerase/N-acetylmannosamine kinase [ Homo sapiens ] |
Official Symbol | GNE |
Synonyms | GNE; glucosamine (UDP-N-acetyl)-2-epimerase/N-acetylmannosamine kinase; IBM2, UDP N acetylglucosamine 2 epimerase/N acetylmannosamine kinase; bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase; Uae1; N-acylmannosamine kinase; UDP-GlcNAc-2-epimerase/ManAc kinase; UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase; UDP-N-acetylglucosamine-2-epimerase/N-acetylmannosamine kinase; NM; DMRV; IBM2; GLCNE; |
Gene ID | 10020 |
mRNA Refseq | NM_001128227 |
Protein Refseq | NP_001121699 |
MIM | 603824 |
UniProt ID | Q9Y223 |
Chromosome Location | 9p13.1 |
Pathway | Amino sugar and nucleotide sugar metabolism, organism-specific biosystem; Amino sugar and nucleotide sugar metabolism, conserved biosystem; CMP-N-acetylneuraminate biosynthesis I (eukaryotes), organism-specific biosystem; Metabolic pathways, organism-specific biosystem; |
Function | ATP binding; N-acylmannosamine kinase activity; UDP-N-acetylglucosamine 2-epimerase activity; isomerase activity; kinase activity; nucleotide binding; transferase activity; |
◆ Recombinant Proteins | ||
HSD17B7-2129H | Recombinant Human HSD17B7 Protein, MYC/DDK-tagged | +Inquiry |
LILRB2-391H | Recombinant Human LILRB2 protein, hFc-tagged | +Inquiry |
RFL23828OF | Recombinant Full Length Oenothera Glazioviana Apocytochrome F(Peta) Protein, His-Tagged | +Inquiry |
RFL19215EF | Recombinant Full Length Escherichia Coli Uncharacterized Protein Yhju(Yhju) Protein, His-Tagged | +Inquiry |
FOXA1-8876Z | Recombinant Zebrafish FOXA1 | +Inquiry |
◆ Native Proteins | ||
ung-8332E | Native E.coli ung | +Inquiry |
Lectin-1737W | Active Native Wheat Germ Agglutinin Protein, Peroxidase conjugated | +Inquiry |
HDL-397H | Native Human High Density Lipoprotein, DiI labeled | +Inquiry |
LDL-396H | Native Human Low Density Lipoprotein, DiI labeled | +Inquiry |
BOD-38 | Active Native Bilirubin oxidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
Parotid-378R | Rhesus monkey Parotid Lysate | +Inquiry |
SELK-582HCL | Recombinant Human SELK lysate | +Inquiry |
RNF144B-2293HCL | Recombinant Human RNF144B 293 Cell Lysate | +Inquiry |
HTATIP2-826HCL | Recombinant Human HTATIP2 cell lysate | +Inquiry |
SHC4-1861HCL | Recombinant Human SHC4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GNE Products
Required fields are marked with *
My Review for All GNE Products
Required fields are marked with *
0
Inquiry Basket