Recombinant Human GNAQ protein, GST-tagged
| Cat.No. : | GNAQ-13350H |
| Product Overview : | Recombinant Human GNAQ protein(NP_002063)(84-205 aa), fused to GST tag, was expressed in E. coli. |
| Availability | December 16, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 84-205 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
| AA Sequence : | FTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPAYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVD |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | GNAQ guanine nucleotide binding protein (G protein), q polypeptide [ Homo sapiens ] |
| Official Symbol | GNAQ |
| Synonyms | GNAQ; guanine nucleotide binding protein (G protein), q polypeptide; guanine nucleotide-binding protein G(q) subunit alpha; G ALPHA q; GAQ; guanine nucleotide-binding protein alpha-q; G-ALPHA-q; |
| Gene ID | 2776 |
| mRNA Refseq | NM_002072.3 |
| Protein Refseq | NP_002063 |
| MIM | 600998 |
| UniProt ID | P50148 |
| ◆ Recombinant Proteins | ||
| GNAQ-88H | Recombinant Human GNAQ Full Length protein, His&Flag-tagged | +Inquiry |
| GNAQ-998H | Recombinant Human GNAQ Protein, His (Fc)-Avi-tagged | +Inquiry |
| GNAQ-2585M | Recombinant Mouse GNAQ Protein (1-359 aa), His-Myc-tagged | +Inquiry |
| GNAQ-2597R | Recombinant Rat GNAQ Protein | +Inquiry |
| GNAQ-5328HF | Recombinant Full Length Human GNAQ Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GNAQ-178HKCL | Human GNAQ Knockdown Cell Lysate | +Inquiry |
| GNAQ-5867HCL | Recombinant Human GNAQ 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GNAQ Products
Required fields are marked with *
My Review for All GNAQ Products
Required fields are marked with *
