Recombinant Human GMPR protein, His-SUMO-tagged
Cat.No. : | GMPR-4033H |
Product Overview : | Recombinant Human GMPR protein(P36959)(1-345aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-345aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 53.4 kDa |
AA Sequence : | MPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFTFRNSKQTYSGIPIIVANMDTVGTFEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAVPQVKFICLDVANGYSEHFVEFVKLVRAKFPEHTIMAGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKGHIISDGGCTCPGDVAKAFGAGADFVMLGGMFSGHTECAGEVFERNGRKLKLFYGMSSDTAMNKHAGGVAEYRASEGKTVEVPYKGDVENTILDILGGLRSTCTYVGAAKLKELSRRATFIRVTQQHNTVFS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | GMPR guanosine monophosphate reductase [ Homo sapiens ] |
Official Symbol | GMPR |
Synonyms | GMPR; guanosine monophosphate reductase; GMP reductase 1; guanine monophosphate reductase; guanosine monophosphate reductase 1; guanosine 5-monophosphate oxidoreductase 1; GMPR1; |
Gene ID | 2766 |
mRNA Refseq | NM_006877 |
Protein Refseq | NP_006868 |
MIM | 139265 |
UniProt ID | P36959 |
◆ Recombinant Proteins | ||
GMPR-13339H | Recombinant Human GMPR, His-tagged | +Inquiry |
GMPR-4033H | Recombinant Human GMPR protein, His-SUMO-tagged | +Inquiry |
GMPR-2588R | Recombinant Rat GMPR Protein | +Inquiry |
GMPR-5020H | Recombinant Human GMPR Protein, GST-tagged | +Inquiry |
GMPR-5419HF | Recombinant Full Length Human GMPR Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GMPR-5877HCL | Recombinant Human GMPR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GMPR Products
Required fields are marked with *
My Review for All GMPR Products
Required fields are marked with *
0
Inquiry Basket