Recombinant Full Length Human GMPR Protein, GST-tagged
Cat.No. : | GMPR-5419HF |
Product Overview : | Human GMPR full-length ORF ( NP_006868.2, 1 a.a. - 345 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 345 amino acids |
Description : | Guanosine monophosphate reductase (EC 1.7.1.7) catalyzes the irreversible NADPH-dependent reductive deamination of guanosine monophosphate (GMP) to inosine monophosphate (IMP). GMPR is able to convert guanosine nucleotides to the pivotal precursor of both guanine (G) and adenine (A) nucleotides. It plays an important role in maintaining the intracellular balance of A and G nucleotides.[supplied by OMIM |
Molecular Mass : | 63.8 kDa |
AA Sequence : | MPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFTFRNSKQTYSGIPIIVANMDTVGTFEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAVPQVKFICLDVANGYSEHFVEFVKLVRAKFPEHTIMAGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKGHIISDGGCTCPGDVAKAFGAGADFVMLGGMFSGHTECAGEVIERNGRKLKLFYGMSSDTAMNKHAGGVAEYRASEGKTVEVPYKGDVENTILDILGGLRSTCTYVGAAKLKELSRRATFIRVTQQHNTVFS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GMPR guanosine monophosphate reductase [ Homo sapiens ] |
Official Symbol | GMPR |
Synonyms | GMPR; guanosine monophosphate reductase; GMP reductase 1; guanine monophosphate reductase; guanosine monophosphate reductase 1; guanosine 5-monophosphate oxidoreductase 1; GMPR1; |
Gene ID | 2766 |
mRNA Refseq | NM_006877 |
Protein Refseq | NP_006868 |
MIM | 139265 |
UniProt ID | P36959 |
◆ Recombinant Proteins | ||
GMPR-3750M | Recombinant Mouse GMPR Protein, His (Fc)-Avi-tagged | +Inquiry |
GMPR-356H | Recombinant Human GMPR, His tagged | +Inquiry |
GMPR-5020H | Recombinant Human GMPR Protein, GST-tagged | +Inquiry |
GMPR-5419HF | Recombinant Full Length Human GMPR Protein, GST-tagged | +Inquiry |
GMPR-13339H | Recombinant Human GMPR, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GMPR-5877HCL | Recombinant Human GMPR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GMPR Products
Required fields are marked with *
My Review for All GMPR Products
Required fields are marked with *
0
Inquiry Basket