Recombinant Human GMFB Protein (142 aa)

Cat.No. : GMFB-390G
Product Overview : Recombinant human Glia Maturation Factor beta (rhGMF-beta) produced in E. coli is a single non-glycosylated polypeptide chain containing 142 amino acids. rhGMF-beta has a molecular mass of 16.7kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 142
Description : Glia Maturation Factor beta (GMF-beta) is a 17 kDa brain specific protein that belongs to the ADF/cofilin superfamily. It is a neurotrophin that induces maturation of neurons and glial cells. Unlike other neurotrophins, GMF-β lacks a leader sequence and can be phosphorylated by protein kinase A and protein kinase C suggesting its role in signal transduction. GMF-β is a prominent mediator of inflammation in the central nervous system and can activate several inflammation-related genes such as tumor necrosis factor-α and interleukin-1β. Researchers have shown there are significantly higher levels of GMF-β protein in all the effected regions of Alzheimer’s disease (AD) brains suggesting an important role of GMF-β in AD pathogenesis.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : Bioassay data are not available.
Molecular Mass : 16.7 kDa, observed by reducing SDS-PAGE.
AA Sequence : MSESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% by SDS-PAGE and HPLC analyses.
Storage : Lyophilized recombinant human Glia Maturation Factor beta (rhGMF-beta) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhGMF-beta remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O at 100 μg/mL.
Gene Name GMFB glia maturation factor, beta [ Homo sapiens ]
Official Symbol GMFB
Synonyms GMFB; glia maturation factor, beta; glia maturation factor beta; GMF; GMF-beta;
Gene ID 2764
mRNA Refseq NM_004124
Protein Refseq NP_004115
MIM 601713
UniProt ID P60983

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GMFB Products

Required fields are marked with *

My Review for All GMFB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon