Recombinant Human GMFB Protein (142 aa)

• Cat.No.: GMFB-390G
• Product Overview: Recombinant human Glia Maturation Factor beta (rhGMF-beta) produced in E. coli is a single non-glycosylated polypeptide chain containing 142 amino acids. rhGMF-beta has a molecular mass of 16.7kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.

Specification

• Species: Human
• Source: E.coli
• Protein Length: 142
• Description: Glia Maturation Factor beta (GMF-beta) is a 17 kDa brain specific protein that belongs to the ADF/cofilin superfamily. It is a neurotrophin that induces maturation of neurons and glial cells. Unlike other neurotrophins, GMF-β lacks a leader sequence and can be phosphorylated by protein kinase A and protein kinase C suggesting its role in signal transduction. GMF-β is a prominent mediator of inflammation in the central nervous system and can activate several inflammation-related genes such as tumor necrosis factor-α and interleukin-1β. Researchers have shown there are significantly higher levels of GMF-β protein in all the effected regions of Alzheimer’s disease (AD) brains suggesting an important role of GMF-β in AD pathogenesis.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: Bioassay data are not available.
• Molecular Mass: 16.7 kDa, observed by reducing SDS-PAGE.
• AA Sequence: MSESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% by SDS-PAGE and HPLC analyses.
• Storage: Lyophilized recombinant human Glia Maturation Factor beta (rhGMF-beta) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhGMF-beta remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O at 100 μg/mL.

Gene Information

• Gene Name: GMFB glia maturation factor, beta [ Homo sapiens ]
• Official Symbol: GMFB
• Synonyms: GMFB; glia maturation factor, beta; glia maturation factor beta; GMF; GMF-beta
• Gene ID: 2764
• mRNA Refseq: NM_004124
• Protein Refseq: NP_004115
• MIM: 601713
• UniProt ID: P60983