Recombinant Full Length Human GMFB Protein, GST-tagged

Cat.No. : GMFB-5409HF
Product Overview : Human GMFB full-length ORF ( AAH05359, 1 a.a. - 154 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 154 amino acids
Description : GMFB (Glia Maturation Factor Beta) is a Protein Coding gene. Among its related pathways are Development Angiotensin activation of ERK and Signal transduction_Erk Interactions- Inhibition of Erk. GO annotations related to this gene include actin binding and growth factor activity. An important paralog of this gene is GMFG.
Molecular Mass : 42.68 kDa
AA Sequence : MSESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFTNVNFCVSKVFMY
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GMFB glia maturation factor, beta [ Homo sapiens ]
Official Symbol GMFB
Synonyms GMFB; glia maturation factor, beta; glia maturation factor beta; GMF; GMF-beta;
Gene ID 2764
mRNA Refseq NM_004124
Protein Refseq NP_004115
MIM 601713
UniProt ID P60983

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GMFB Products

Required fields are marked with *

My Review for All GMFB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon