Recombinant Full Length Human GMFB Protein, GST-tagged
Cat.No. : | GMFB-5409HF |
Product Overview : | Human GMFB full-length ORF ( AAH05359, 1 a.a. - 154 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 154 amino acids |
Description : | GMFB (Glia Maturation Factor Beta) is a Protein Coding gene. Among its related pathways are Development Angiotensin activation of ERK and Signal transduction_Erk Interactions- Inhibition of Erk. GO annotations related to this gene include actin binding and growth factor activity. An important paralog of this gene is GMFG. |
Molecular Mass : | 42.68 kDa |
AA Sequence : | MSESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFTNVNFCVSKVFMY |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GMFB glia maturation factor, beta [ Homo sapiens ] |
Official Symbol | GMFB |
Synonyms | GMFB; glia maturation factor, beta; glia maturation factor beta; GMF; GMF-beta; |
Gene ID | 2764 |
mRNA Refseq | NM_004124 |
Protein Refseq | NP_004115 |
MIM | 601713 |
UniProt ID | P60983 |
◆ Recombinant Proteins | ||
GMFB-12333Z | Recombinant Zebrafish GMFB | +Inquiry |
Gmfb-034G | Recombinant Rat Gmfb Protein (141 aa) | +Inquiry |
GMFB-2585R | Recombinant Rat GMFB Protein | +Inquiry |
GMFB-3746M | Recombinant Mouse GMFB Protein, His (Fc)-Avi-tagged | +Inquiry |
GMFB-2794H | Recombinant Human Glia Maturation Factor, Beta, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GMFB-5883HCL | Recombinant Human GMFB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GMFB Products
Required fields are marked with *
My Review for All GMFB Products
Required fields are marked with *
0
Inquiry Basket