Recombinant Human GLRX3 protein, T7-tagged
Cat.No. : | GLRX3-194H |
Product Overview : | Recombinant human GLRX3 (335 aa) fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | T7 |
Protein Length : | 335 a.a. |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGEFGSMAAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAK ELPQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFLPSANEHLKEDL NLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKAYSSWPTYPQLYVSGE LIGGLDIIKELEASEELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDI LEDEEVRQGLKAYSNWPTYPQLYVKGELVGGLDIVKELKENGELLPILRGEN |
Purity : | >90% by SDS-PAGE. |
Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
Gene Name | GLRX3 glutaredoxin 3 [ Homo sapiens ] |
Official Symbol | GLRX3 |
Synonyms | GLRX3; glutaredoxin 3; thioredoxin like 2 , TXNL2; glutaredoxin-3; bA500G10.4; GLRX4; glutaredoxin 4; GRX3; GRX4; PICOT; PKCq-interacting protein; TXNL2; TXNL3; FLJ11864; |
Gene ID | 10539 |
mRNA Refseq | NM_001199868 |
Protein Refseq | NP_001186797 |
MIM | 612754 |
UniProt ID | O76003 |
Chromosome Location | 10q26 |
Function | electron carrier activity; iron-sulfur cluster binding; metal ion binding; protein binding; protein disulfide oxidoreductase activity; protein kinase C binding; |
◆ Recombinant Proteins | ||
GLRX3-194H | Recombinant Human GLRX3 protein, T7-tagged | +Inquiry |
GLRX3-6424M | Recombinant Mouse GLRX3 Protein | +Inquiry |
GLRX3-13313H | Recombinant Human GLRX3, GST-tagged | +Inquiry |
GLRX3-627H | Recombinant Human GLRX3 Protein, His-tagged | +Inquiry |
GLRX3-5073H | Recombinant Human GLRX3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
GLRX3-5897HCL | Recombinant Human GLRX3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GLRX3 Products
Required fields are marked with *
My Review for All GLRX3 Products
Required fields are marked with *
0
Inquiry Basket