Recombinant Human GLRX3 protein, T7-tagged

Cat.No. : GLRX3-194H
Product Overview : Recombinant human GLRX3 (335 aa) fused with T7 Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : T7
Protein Length : 335 a.a.
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGEFGSMAAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAK ELPQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFLPSANEHLKEDL NLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKAYSSWPTYPQLYVSGE LIGGLDIIKELEASEELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDI LEDEEVRQGLKAYSNWPTYPQLYVKGELVGGLDIVKELKENGELLPILRGEN
Purity : >90% by SDS-PAGE.
Storage : Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name GLRX3 glutaredoxin 3 [ Homo sapiens ]
Official Symbol GLRX3
Synonyms GLRX3; glutaredoxin 3; thioredoxin like 2 , TXNL2; glutaredoxin-3; bA500G10.4; GLRX4; glutaredoxin 4; GRX3; GRX4; PICOT; PKCq-interacting protein; TXNL2; TXNL3; FLJ11864;
Gene ID 10539
mRNA Refseq NM_001199868
Protein Refseq NP_001186797
MIM 612754
UniProt ID O76003
Chromosome Location 10q26
Function electron carrier activity; iron-sulfur cluster binding; metal ion binding; protein binding; protein disulfide oxidoreductase activity; protein kinase C binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GLRX3 Products

Required fields are marked with *

My Review for All GLRX3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon