Recombinant Human GLRX2 Protein, GST-tagged

• Cat.No.: GLRX2-4976H
• Product Overview: Human GLRX2 full-length ORF ( AAH28113, 1 a.a. - 124 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Glutaredoxins (e.g., GLRX; MIM 600443) are a family of glutathione-dependent hydrogen donors that participate in a variety of cellular redox reactions.[supplied by OMIM
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 39.38 kDa
• AA Sequence: MESNTSSSLENLATAPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYLKKSKRKEFQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GLRX2 glutaredoxin 2 [ Homo sapiens ]
• Official Symbol: GLRX2
• Synonyms: GLRX2; glutaredoxin 2; bA101E13.1; bA101E13.1 (GRX2 glutaredoxin (thioltransferase) 2); GRX2; CGI-133
• Gene ID: 51022
• mRNA Refseq: NM_001243399
• Protein Refseq: NP_001230328
• MIM: 606820
• UniProt ID: Q9NS18