Recombinant Human GLO1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | GLO1-4020H |
Product Overview : | GLO1 MS Standard C13 and N15-labeled recombinant protein (NP_006699) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The enzyme encoded by this gene is responsible for the catalysis and formation of S-lactoyl-glutathione from methylglyoxal condensation and reduced glutatione. Glyoxalase I is linked to HLA and is localized to 6p21.3-p21.1, between HLA and the centromere. |
Molecular Mass : | 20.8 kDa |
AA Sequence : | MAEPQPPSGGLTDEAALSYCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKMATLMTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | GLO1 glyoxalase I [ Homo sapiens (human) ] |
Official Symbol | GLO1 |
Synonyms | GLO1; glyoxalase I; lactoylglutathione lyase; GLOD1; glyoxalase domain containing 1; glx I; aldoketomutase; methylglyoxalase; ketone-aldehyde mutase; lactoyl glutathione lyase; S-D-lactoylglutathione methylglyoxal lyase; GLYI; |
Gene ID | 2739 |
mRNA Refseq | NM_006708 |
Protein Refseq | NP_006699 |
MIM | 138750 |
UniProt ID | Q04760 |
◆ Recombinant Proteins | ||
GLO1-548C | Recombinant Cynomolgus GLO1 Protein, His-tagged | +Inquiry |
GLO1-4698H | Recombinant Human GLO1 protein, His-tagged | +Inquiry |
GLO1-4020H | Recombinant Human GLO1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GLO1-574H | Active Recombinant Human GLO1 Protein, Met & His-tagged | +Inquiry |
GLO1-2563R | Recombinant Rat GLO1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GLO1-5899HCL | Recombinant Human GLO1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GLO1 Products
Required fields are marked with *
My Review for All GLO1 Products
Required fields are marked with *
0
Inquiry Basket