Recombinant Human GLIPR1L1 Protein, GST-tagged

Cat.No. : GLIPR1L1-4960H
Product Overview : Human GLIPR1L1 full-length ORF ( NP_689992.1, 1 a.a. - 233 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : GLIPR1L1 (GLI Pathogenesis Related 1 Like 1) is a Protein Coding gene. An important paralog of this gene is GLIPR1.
Molecular Mass : 52.5 kDa
AA Sequence : MALKNKFSCLWILGLCLVATTSSKIPSITDPHFIDNCIEAHNEWRGKVNPPAADMKYMIWDKGLAKMAKAWANQCKFEHNDCLDKSYKCYAAFEYVGENIWLGGIKSFTPRHAITAWYNETQFYDFDSLSCSRVCGHYTQLVWANSFYVGCAVAMCPNLGGASTAIFVCNYGPAGNFANMPPYVRGESCSLCSKEEKCVKNLCKNPFLKPTGRAPQQTAFNPFSLGFLLLRIF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GLIPR1L1 GLI pathogenesis-related 1 like 1 [ Homo sapiens ]
Official Symbol GLIPR1L1
Synonyms GLIPR1L1; GLI pathogenesis-related 1 like 1; GLIPR1-like protein 1; MGC26856; PRO7434; ALKN2972;
Gene ID 256710
mRNA Refseq NM_152779
Protein Refseq NP_689992
MIM 610395
UniProt ID Q6UWM5

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GLIPR1L1 Products

Required fields are marked with *

My Review for All GLIPR1L1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon