Recombinant Full Length Human GLIPR1L1 Protein, GST-tagged

• Cat.No.: GLIPR1L1-5330HF
• Product Overview: Human GLIPR1L1 full-length ORF ( NP_689992.1, 1 a.a. - 233 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: GLIPR1L1 (GLI Pathogenesis Related 1 Like 1) is a Protein Coding gene. An important paralog of this gene is GLIPR1.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 52.5 kDa
• Protein length: 233 amino acids
• AA Sequence: MALKNKFSCLWILGLCLVATTSSKIPSITDPHFIDNCIEAHNEWRGKVNPPAADMKYMIWDKGLAKMAKAWANQCKFEHNDCLDKSYKCYAAFEYVGENIWLGGIKSFTPRHAITAWYNETQFYDFDSLSCSRVCGHYTQLVWANSFYVGCAVAMCPNLGGASTAIFVCNYGPAGNFANMPPYVRGESCSLCSKEEKCVKNLCKNPFLKPTGRAPQQTAFNPFSLGFLLLRIF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GLIPR1L1 GLI pathogenesis-related 1 like 1 [ Homo sapiens ]
• Official Symbol: GLIPR1L1
• Synonyms: GLIPR1L1; GLI pathogenesis-related 1 like 1; GLIPR1-like protein 1; MGC26856; PRO7434; ALKN2972
• Gene ID: 256710
• mRNA Refseq: NM_152779
• Protein Refseq: NP_689992
• MIM: 610395
• UniProt ID: Q6UWM5