Recombinant Human GLI4 Protein, GST-tagged

Cat.No. : GLI4-4957H
Product Overview : Human GLI4 full-length ORF ( NP_612474.1, 1 a.a. - 376 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : GLI4 (GLI Family Zinc Finger 4) is a Protein Coding gene. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding. An important paralog of this gene is ZNF696.
Molecular Mass : 67.5 kDa
AA Sequence : MAALGDIQESPSVPSPVSLSSPGTPGTQHHEPQLHLHGHQHGSPGSSPKVLSQPSDLDLQDVEEVEIGRDTFWPDSEPKPEQAPRSPGSQAPDEGAGGALRSLLRSLPRRARCSAGFGPESSAERPAGQPPGAVPCAQPRGAWRVTLVQQAAAGPEGAPERAAELGVNFGRSRQGSARGAKPHRCEACGKSFKYNSLLLKHQRIHTGEKPYACHECGKRFRGWSGFIQHHRIHTGEKPYECGQCGRAFSHSSHFTQHLRIHNGEKPYKCGECGQAFSQSSNLVRHQRLHTGEKPYACSQCGKAFIWSSVLIEHQRIHTGEKPYECSDCGKAFRGRSHFFRHLRTHTGEKPFACGACGKAFGQSSQLIQHQRVHYRE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GLI4 GLI family zinc finger 4 [ Homo sapiens ]
Official Symbol GLI4
Synonyms GLI4; GLI family zinc finger 4; GLI Kruppel family member GLI4, glioma associated oncogene family zinc finger 4; zinc finger protein GLI4; HKR4; ZNF928; krueppel-related zinc finger protein 4; GLI-Kruppel family member GLI4 (oncogene HKR4); glioma-associated oncogene family zinc finger 4;
Gene ID 2738
mRNA Refseq NM_138465
Protein Refseq NP_612474
MIM 165280
UniProt ID P10075

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GLI4 Products

Required fields are marked with *

My Review for All GLI4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon