Recombinant Full Length Human GLI4 Protein, GST-tagged

• Cat.No.: GLI4-5329HF
• Product Overview: Human GLI4 full-length ORF ( NP_612474.1, 1 a.a. - 376 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 376 amino acids
• Description: GLI4 (GLI Family Zinc Finger 4) is a Protein Coding gene. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding. An important paralog of this gene is ZNF696.
• Molecular Mass: 67.5 kDa
• AA Sequence: MAALGDIQESPSVPSPVSLSSPGTPGTQHHEPQLHLHGHQHGSPGSSPKVLSQPSDLDLQDVEEVEIGRDTFWPDSEPKPEQAPRSPGSQAPDEGAGGALRSLLRSLPRRARCSAGFGPESSAERPAGQPPGAVPCAQPRGAWRVTLVQQAAAGPEGAPERAAELGVNFGRSRQGSARGAKPHRCEACGKSFKYNSLLLKHQRIHTGEKPYACHECGKRFRGWSGFIQHHRIHTGEKPYECGQCGRAFSHSSHFTQHLRIHNGEKPYKCGECGQAFSQSSNLVRHQRLHTGEKPYACSQCGKAFIWSSVLIEHQRIHTGEKPYECSDCGKAFRGRSHFFRHLRTHTGEKPFACGACGKAFGQSSQLIQHQRVHYRE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GLI4 GLI family zinc finger 4 [ Homo sapiens ]
• Official Symbol: GLI4
• Synonyms: GLI4; GLI family zinc finger 4; GLI Kruppel family member GLI4, glioma associated oncogene family zinc finger 4; zinc finger protein GLI4; HKR4; ZNF928; krueppel-related zinc finger protein 4; GLI-Kruppel family member GLI4 (oncogene HKR4); glioma-associated oncogene family zinc finger 4
• Gene ID: 2738
• mRNA Refseq: NM_138465
• Protein Refseq: NP_612474
• MIM: 165280
• UniProt ID: P10075