Recombinant Human GLI1 protein, His-tagged
Cat.No. : | GLI1-3146H |
Product Overview : | Recombinant Human GLI1 protein(470-659 aa), fused to His tag, was expressed in E. coli. |
Availability | April 19, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 470-659 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | NAGGSTEDLSSLDEGPCIAGTGLSTLRRLENLRLDQLHQLRPIGTRGLKLPSLSHTGTTVSRRVGPPVSLERRSSSSSSISSAYTVSRRSSLASPFPPGSPPENGASSLPGLMPAQHYLLRARYASARGGGTSPTAASSLDRIGGLPMPPWRSRAEYPGYNPNAGVTRRASDPAQAADRPAPARVQRFKS |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | GLI1 GLI family zinc finger 1 [ Homo sapiens ] |
Official Symbol | GLI1 |
Synonyms | GLI1; GLI family zinc finger 1; GLI, glioma associated oncogene family zinc finger 1 , glioma associated oncogene homolog 1 (zinc finger protein); zinc finger protein GLI1; oncogene GLI; glioma-associated oncogene 1; glioma-associated oncogene homolog 1 (zinc finger protein); GLI; |
Gene ID | 2735 |
mRNA Refseq | NM_001160045 |
Protein Refseq | NP_001153517 |
MIM | 165220 |
UniProt ID | P08151 |
◆ Recombinant Proteins | ||
Gli1-139R | Recombinant Rat Gli1 protein, His-tagged | +Inquiry |
GLI1-3594M | Recombinant Mouse GLI1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Gli1-3224M | Recombinant Mouse Gli1 Protein, Myc/DDK-tagged | +Inquiry |
GLI1-4131HFL | Recombinant Full Length Human GLI1 protein, Flag-tagged | +Inquiry |
GLI1-4276H | Recombinant Human GLI1 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
GLI1-6401M | Recombinant Full Length Mouse GLI1 Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GLI1-5905HCL | Recombinant Human GLI1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GLI1 Products
Required fields are marked with *
My Review for All GLI1 Products
Required fields are marked with *
0
Inquiry Basket