Recombinant Human GLI1 protein, His-tagged

• Cat.No.: GLI1-4276H
• Product Overview: Recombinant Human GLI1 protein(P08151)(921-1106aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 921-1106aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 23.3 kDa
• AA Sequence: QEPSYQSPKFLGGSQVSPSRAKAPVNTYGPGFGPNLPNHKSGSYPTPSPCHENFVVGANRASHRAAAPPRLLPPLPTCYGPLKVGGTNPSCGHPEVGRLGGGPALYPPPEGQVCNPLDSLDLDNTQLDFVAILDEPQGLSPPPSHDQRGSSGHTPPPSGPPNMAVGNMSVLLRSLPGETEFLNSSA
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: GLI1 GLI family zinc finger 1 [ Homo sapiens ]
• Official Symbol: GLI1
• Synonyms: GLI1; GLI family zinc finger 1; GLI, glioma associated oncogene family zinc finger 1 , glioma associated oncogene homolog 1 (zinc finger protein); zinc finger protein GLI1; oncogene GLI; glioma-associated oncogene 1; glioma-associated oncogene homolog 1 (zinc finger protein); GLI
• Gene ID: 2735
• mRNA Refseq: NM_001160045
• Protein Refseq: NP_001153517
• MIM: 165220
• UniProt ID: P08151