Recombinant Human GKN1 Protein, His-tagged

• Cat.No.: GKN1-01H
• Product Overview: Recombinant human GKN1 protein (1-199aa, 223aa), fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques.

Specification

• Description: The protein encoded by this gene is found to be down-regulated in human gastric cancer tissue as compared to normal gastric mucosa.
• Form: Liquid
• Molecular Mass: 24.5 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMGSHMLAYSSVHCFREDKMKFTIVFAGLLGVFLAPALANYNINVNDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKLQGKGPGGPPPKGLMYSVNPNKVDDLSKFGKNIANMCRGIPTYMAEEMQEASLFFYSGTCYTTSVLWIVDISFCGDTVEN
• Purity: > 85% by SDS-PAGE
• Applications: SDS-PAGE
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 0.25 mg/mL (determined by Bradford assay)
• Storage Buffer: 20mM Tris-HCl (pH 8.0) containing 0.1M NaCl, 10% glycerol, 1mM DTT
• Protein length: 1-199 a.a.

Gene Information

• Gene Name: GKN1 gastrokine 1 [ Homo sapiens (human) ]
• Official Symbol: GKN1
• Synonyms: GKN1; gastrokine 1; FOV; CA11; AMP18; BRICD1; foveolin; gastrokine-1; 18 kDa antrum mucosa protein; BRICHOS domain containing 1
• Gene ID: 56287
• mRNA Refseq: NM_019617
• Protein Refseq: NP_062563
• MIM: 606402
• UniProt ID: Q9NS71