Recombinant Human GKN1 protein, His&Myc-tagged
Cat.No. : | GKN1-5363H |
Product Overview : | Recombinant Human GKN1 protein(Q9NS71)(35-199aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 35-199aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 25.7 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | NYNINVNDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKLQGKGPGGPPPKGLMYSVNPNKVDDLSKFGKNIANMCRGIPTYMAEEMQEASLFFYSGTCYTTSVLWIVDISFCGDTVEN |
Gene Name | GKN1 gastrokine 1 [ Homo sapiens ] |
Official Symbol | GKN1 |
Synonyms | GKN1; gastrokine 1; gastrokine-1; AMP18; BRICD1; CA11; AMP-18; BRICHOS domain containing 1; 18 kDa antrum mucosa protein; FOV; foveolin; MGC70354; |
Gene ID | 56287 |
mRNA Refseq | NM_019617 |
Protein Refseq | NP_062563 |
MIM | 606402 |
UniProt ID | Q9NS71 |
◆ Recombinant Proteins | ||
GKN1-5643H | Recombinant Human GKN1 protein, His-tagged | +Inquiry |
GKN1-7831P | Recombinant Pig GKN1 protein, His-tagged | +Inquiry |
GKN1-5454H | Recombinant Human GKN1 protein, His-tagged | +Inquiry |
GKN1-223H | Recombinant Human Gastrokine 1, His-tagged | +Inquiry |
GKN1-3572H | Recombinant Human GKN1 Protein (Ala22-Asn199), N-GST tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GKN1-001HCL | Recombinant Human GKN1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GKN1 Products
Required fields are marked with *
My Review for All GKN1 Products
Required fields are marked with *
0
Inquiry Basket