Recombinant Human GIT2 protein, GST-tagged

• Cat.No.: GIT2-3736H
• Product Overview: Recombinant Human GIT2 protein, fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: SSLSGSKDNVELILKTINNQHSVESQDNDQPDYDSVASDEDTDLETTASKTNRQKSLDSDLSDGPVTVQEFMEVKNALVAS
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: GIT2 G protein-coupled receptor kinase interacting ArfGAP 2 [ Homo sapiens ]
• Official Symbol: GIT2
• Synonyms: GIT2; G protein-coupled receptor kinase interacting ArfGAP 2; G protein coupled receptor kinase interactor 2; ARF GTPase-activating protein GIT2; KIAA0148; ARF GAP GIT2; GRK-interacting protein 2; G protein-coupled receptor kinase-interactor 2; cool-associated, tyrosine phosphorylated protein 2; cool-interacting tyrosine-phosphorylated protein 2; CAT2; CAT-2; MGC760; DKFZp686G01261
• Gene ID: 9815
• mRNA Refseq: NM_001135213
• Protein Refseq: NP_001128685
• MIM: 608564
• UniProt ID: Q14161