Recombinant Human GHR, Fc-tagged

• Cat.No.: GHR-28186TH
• Product Overview: Recombinant fragment, corresponding to extracellular amino acids 19-254 of Human Growth hormone receptor fused to the Fc region of Human IgG1 (aa 93-330). The chimeric protein was expressed in modified human 293 cells.

Specification

• Description: This gene encodes a member of the type I cytokine receptor family, which is a transmembrane receptor for growth hormone. Binding of growth hormone to the receptor leads to receptor dimerization and the activation of an intra- and intercellular signal transduction pathway leading to growth. Mutations in this gene have been associated with Laron syndrome, also known as the growth hormone insensitivity syndrome (GHIS), a disorder characterized by short stature. In humans and rabbits, but not rodents, growth hormone binding protein (GHBP) is generated by proteolytic cleavage of the extracellular ligand-binding domain from the mature growth hormone receptor protein. Multiple alternatively spliced transcript variants have been found for this gene.
• Conjugation: Fc
• Tissue specificity: Expressed in various tissues with high expression in liver and skeletal muscle. Isoform 4 is predominantly expressed in kidney, bladder, adrenal gland and brain stem. Isoform 1 expression in placenta is predominant in chorion and decidua. Isoform 4 is hig
• Form: Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not reco
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin
• Storage: Store at +4°C.
• Sequences of amino acids: Theoretical sequence: FSGSEATAAILSRAPWSLQSVNPGLKTNSSKEPKFTKC RSPERETFSCHWTDEVHHGTKNLGPIQLFYTRRNTQEW TQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSN GGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHAD IQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLY VTLPQMRIPKVDKKVEPKSCDKTHTCPPCPAPELLGGP SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFN WYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWL NGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYK TTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHE ALHNHYTQKSLSLSPGK
• Sequence Similarities: Belongs to the type I cytokine receptor family. Type 1 subfamily.Contains 1 fibronectin type-III domain.
• Protein length: 19-254 a.a.

Gene Information

• Gene Name: GHR growth hormone receptor [ Homo sapiens ]
• Official Symbol: GHR
• Synonyms: GHR; growth hormone receptor
• Gene ID: 2690
• mRNA Refseq: NM_000163
• Protein Refseq: NP_000154
• MIM: 600946
• Uniprot ID: P10912
• Chromosome Location: 5p14-p12
• Pathway: Androgen Receptor Signaling Pathway, organism-specific biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Endochondral Ossification, organism-specific biosystem
• Function: SH2 domain binding; growth factor binding; growth hormone receptor activity; peptide hormone binding; proline-rich region binding