Recombinant Human GHR, Fc-tagged

Cat.No. : GHR-28186TH
Product Overview : Recombinant fragment, corresponding to extracellular amino acids 19-254 of Human Growth hormone receptor fused to the Fc region of Human IgG1 (aa 93-330). The chimeric protein was expressed in modified human 293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Tag : Fc
Protein Length : 19-254 a.a.
Description : This gene encodes a member of the type I cytokine receptor family, which is a transmembrane receptor for growth hormone. Binding of growth hormone to the receptor leads to receptor dimerization and the activation of an intra- and intercellular signal transduction pathway leading to growth. Mutations in this gene have been associated with Laron syndrome, also known as the growth hormone insensitivity syndrome (GHIS), a disorder characterized by short stature. In humans and rabbits, but not rodents, growth hormone binding protein (GHBP) is generated by proteolytic cleavage of the extracellular ligand-binding domain from the mature growth hormone receptor protein. Multiple alternatively spliced transcript variants have been found for this gene.
Conjugation : Fc
Tissue specificity : Expressed in various tissues with high expression in liver and skeletal muscle. Isoform 4 is predominantly expressed in kidney, bladder, adrenal gland and brain stem. Isoform 1 expression in placenta is predominant in chorion and decidua. Isoform 4 is hig
Form : Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not reco
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin
Storage : Store at +4°C.
Sequences of amino acids : Theoretical sequence: FSGSEATAAILSRAPWSLQSVNPGLKTNSSKEPKFTKC RSPERETFSCHWTDEVHHGTKNLGPIQLFYTRRNTQEW TQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSN GGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHAD IQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLY VTLPQMRIPKVDKKVEPKSCDKTHTCPPCPAPELLGGP SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFN WYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWL NGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYK TTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHE ALHNHYTQKSLSLSPGK
Sequence Similarities : Belongs to the type I cytokine receptor family. Type 1 subfamily.Contains 1 fibronectin type-III domain.
Gene Name GHR growth hormone receptor [ Homo sapiens ]
Official Symbol GHR
Synonyms GHR; growth hormone receptor;
Gene ID 2690
mRNA Refseq NM_000163
Protein Refseq NP_000154
MIM 600946
Uniprot ID P10912
Chromosome Location 5p14-p12
Pathway Androgen Receptor Signaling Pathway, organism-specific biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Endochondral Ossification, organism-specific biosystem;
Function SH2 domain binding; growth factor binding; growth hormone receptor activity; peptide hormone binding; proline-rich region binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GHR Products

Required fields are marked with *

My Review for All GHR Products

Required fields are marked with *

0

Inquiry Basket

cartIcon