Recombinant Human GH1 Protein, His-tagged

• Cat.No.: GH1-34H
• Product Overview: Recombinant Human GH1 Protein, fused to His-tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. The gene, along with four other related genes, is located at the growth hormone locus on chromosome 17 where they are interspersed in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. The five genes share a remarkably high degree of sequence identity. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. This particular family member is expressed in the pituitary but not in placental tissue as is the case for the other four genes in the growth hormone locus. Mutations in or deletions of the gene lead to growth hormone deficiency and short stature.
• Form: Supplied as a 0.2 μm filtered solution in 20 mM Tris, 300mM NaCl, pH8.0.
• Molecular Mass: ~18.1 KDa
• AA Sequence: MFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGFLEHHHHHH
• Purity: >90%
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.12 mg/mL

Gene Information

• Gene Name: GH1 growth hormone 1 [ Homo sapiens (human) ]
• Official Symbol: GH1
• Synonyms: GH; GHN; GH-N; GHB5; IGHD2; hGH-N; IGHD1A; IGHD1B
• Gene ID: 2688
• mRNA Refseq: NM_000515
• Protein Refseq: NP_000506
• MIM: 139250
• UniProt ID: P01241