Recombinant Human GH1 Protein, GST-tagged
Cat.No. : | GH1-4883H |
Product Overview : | Human GH1 full-length ORF ( AAH75012.1, 1 a.a. - 217 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. The gene, along with four other related genes, is located at the growth hormone locus on chromosome 17 where they are interspersed in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. The five genes share a remarkably high degree of sequence identity. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. This particular family member is expressed in the pituitary but not in placental tissue as is the case for the other four genes in the growth hormone locus. Mutations in or deletions of the gene lead to growth hormone deficiency and short stature. [provided by RefSeq |
Molecular Mass : | 51.2 kDa |
AA Sequence : | MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GH1 growth hormone 1 [ Homo sapiens ] |
Official Symbol | GH1 |
Synonyms | GH1; growth hormone 1; somatotropin; GH; GH N; GHN; hGH N; pituitary growth hormone; GH-N; hGH-N; IGHD1B; |
Gene ID | 2688 |
mRNA Refseq | NM_000515 |
Protein Refseq | NP_000506 |
MIM | 139250 |
UniProt ID | P01241 |
◆ Recombinant Proteins | ||
GH1-6856H | Recombinant Human GH1 protein, His-tagged | +Inquiry |
GH1-2692Z | Recombinant Zebrafish GH1 | +Inquiry |
GH1-950P | Recombinant Pig GH1 protein, His-tagged | +Inquiry |
GH1-28093TH | Recombinant Human GH1 protein | +Inquiry |
GH1-2010H | Recombinant Human GH1 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
GH1-5354H | Native Human Growth Hormone 1 | +Inquiry |
GH1-8147H | Native Growth Hormone (GH) | +Inquiry |
◆ Cell & Tissue Lysates | ||
GH1-5944HCL | Recombinant Human GH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GH1 Products
Required fields are marked with *
My Review for All GH1 Products
Required fields are marked with *
0
Inquiry Basket