Recombinant Human GGTLC1 Protein, GST-tagged
Cat.No. : | GGTLC1-4881H |
Product Overview : | Human GGTLA4 full-length ORF ( NP_563577.1, 1 a.a. - 225 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the gamma-glutamyl transpeptidase (GGT) family, which are important in the metabolism of glutathione. The most ubiquitously expressed human GGT gene, GGT1, encodes a single transmembrane polypeptide that is post-translationally processed to form a heavy and a light chain. In contrast, the product of this gene only contains homology to the light chain region, and lacks a transmembrane domain. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq |
Molecular Mass : | 50.7 kDa |
AA Sequence : | MTSEFFSAQLRAQISDDTTHPISYYKPEFYMPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILLNNEMDDFSSTSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVGAAGGTQITMATALAIIYNLWFGYDVKWAVEEPRLHNQLLPNVTTVERNIDQEVTAALETRHHHTQITSTFIAVVQAIVRMAGGWAAASDSRKGGEPAGY |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GGTLC1 gamma-glutamyltransferase light chain 1 [ Homo sapiens ] |
Official Symbol | GGTLC1 |
Synonyms | gamma-glutamyltransferase light chain 1; 16437; Ensembl:ENSG00000149435; MGC50550; gamma-glutamyltransferase light chain 1;gamma-glutamyl transpeptidase;gamma-glutamyltransferase-like protein 6;gamma-glutamyltransferase-like activity 3;gamma-glutamyltransferase-like activity 4; 2.3.2.2; GGTL6; GGTLA3; GGTLA4; dJ831C21.1; dJ831C21.2 |
Gene ID | 92086 |
mRNA Refseq | NM_178311 |
Protein Refseq | NP_842563 |
MIM | 612338 |
UniProt ID | Q9BX51 |
◆ Recombinant Proteins | ||
GGTLC1-4881H | Recombinant Human GGTLC1 Protein, GST-tagged | +Inquiry |
GGTLC1-5245HF | Recombinant Full Length Human GGTLC1 Protein, GST-tagged | +Inquiry |
GGTLC1-13246H | Recombinant Human GGTLC1, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GGTLC1-703HCL | Recombinant Human GGTLC1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GGTLC1 Products
Required fields are marked with *
My Review for All GGTLC1 Products
Required fields are marked with *
0
Inquiry Basket